ACTR6 polyclonal antibody
  • ACTR6 polyclonal antibody

ACTR6 polyclonal antibody

Ref: AB-PAB23310
ACTR6 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ACTR6.
Información adicional
Size 100 uL
Gene Name ACTR6
Gene Alias ARP6|CDA12|FLJ13433|HSPC281|MSTP136|hARP6|hARPX
Gene Description ARP6 actin-related protein 6 homolog (yeast)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq NAGALSAHRYFRDNPSELCCIIVDSGYSFTHIVPYCRSKKKKEAIIRINVGGKLLTNHLKEIISYRQLHVMDETHVINQVKEDVCYV
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ACTR6.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64431
Iso type IgG

Enviar uma mensagem


ACTR6 polyclonal antibody

ACTR6 polyclonal antibody