C2CD3 polyclonal antibody
  • C2CD3 polyclonal antibody

C2CD3 polyclonal antibody

Ref: AB-PAB23304
C2CD3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C2CD3.
Información adicional
Size 100 uL
Gene Name C2CD3
Gene Alias DKFZp586P0123|FLJ34770
Gene Description C2 calcium-dependent domain containing 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ELMVKSSFLSSPERAVNPHLPRQGSPSQSLVACECEASKARVGGESASANPQPIPCPTLSGAQQSSTFVGWSSPQTDQNKEPKS
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C2CD3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26005
Iso type IgG

Enviar uma mensagem


C2CD3 polyclonal antibody

C2CD3 polyclonal antibody