PPRC1 polyclonal antibody
  • PPRC1 polyclonal antibody

PPRC1 polyclonal antibody

Ref: AB-PAB23299
PPRC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PPRC1.
Información adicional
Size 100 uL
Gene Name PPRC1
Gene Alias KIAA0595|MGC74642|PRC|RP11-302K17.6
Gene Description peroxisome proliferator-activated receptor gamma, coactivator-related 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P,IF
Immunogen Prot. Seq ASPHPKHKVSALVQSPQMKALACVSAEGVTVEEPASERLKPETQETRPREKPPLPATKAVPTPRQSTVPKLPAVHPARLRKLSFLPTPRTQGSEDVVQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PPRC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23082
Iso type IgG

Enviar uma mensagem


PPRC1 polyclonal antibody

PPRC1 polyclonal antibody