KANSL2 polyclonal antibody
  • KANSL2 polyclonal antibody

KANSL2 polyclonal antibody

Ref: AB-PAB23296
KANSL2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KANSL2.
Información adicional
Size 100 uL
Gene Name KANSL2
Gene Alias C12orf41|NSL2
Gene Description KAT8 regulatory NSL complex subunit 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MKKTNPGPVGETLLCQLSSYAKTELGSQTPESSRSEASRILDEDSWSDGEQEPITVDQTWRGDPDSEADSIDSDQEDP
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KANSL2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54934
Iso type IgG

Enviar uma mensagem


KANSL2 polyclonal antibody

KANSL2 polyclonal antibody