ME3 polyclonal antibody
  • ME3 polyclonal antibody

ME3 polyclonal antibody

Ref: AB-PAB23293
ME3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ME3.
Información adicional
Size 100 uL
Gene Name ME3
Gene Alias FLJ34862
Gene Description malic enzyme 3, NADP(+)-dependent, mitochondrial
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq DVSLRIAIKVLDYAYKHNLASYYPEPKDKEAFVRSLVYTPDYDSFTLDSYTWPKEAMNVQTV
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ME3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10873
Iso type IgG

Enviar uma mensagem


ME3 polyclonal antibody

ME3 polyclonal antibody