SNX22 polyclonal antibody
  • SNX22 polyclonal antibody

SNX22 polyclonal antibody

Ref: AB-PAB23292
SNX22 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SNX22.
Información adicional
Size 100 uL
Gene Name SNX22
Gene Alias FLJ13952
Gene Description sorting nexin 22
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GLEAYIQGILYLNQEVPKELLEFLRLRHFPTDPKASNWGTLREFLPGDSSSQQHQRPVLSFHVDPYVCNPSPESLPNVVVNGVLQGLYSFSISPDKAQPKAACHPAPL
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SNX22.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79856
Iso type IgG

Enviar uma mensagem


SNX22 polyclonal antibody

SNX22 polyclonal antibody