CNPY2 polyclonal antibody
  • CNPY2 polyclonal antibody

CNPY2 polyclonal antibody

Ref: AB-PAB23291
CNPY2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CNPY2.
Información adicional
Size 100 uL
Gene Name CNPY2
Gene Alias HP10390|MSAP|TMEM4|ZSIG9
Gene Description canopy 2 homolog (zebrafish)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RRSQDLHCGACRALVDELEWEIAQVDPKKTIQMGSFRINPDGSQSVVEVPYARSEAHLTELLEEICDRMKEYGEQIDPSTHRKNYVRVVGRNGESSELDLQGIRIDSD
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CNPY2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10330
Iso type IgG

Enviar uma mensagem


CNPY2 polyclonal antibody

CNPY2 polyclonal antibody