BFSP2 polyclonal antibody
  • BFSP2 polyclonal antibody

BFSP2 polyclonal antibody

Ref: AB-PAB23290
BFSP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BFSP2.
Información adicional
Size 100 uL
Gene Name BFSP2
Gene Alias CP47|CP49|LIFL-L|MGC142078|MGC142080|PHAKOSIN
Gene Description beaded filament structural protein 2, phakinin
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq LSRNYEEDVKLLHKQLAGCELEQMDAPIGTGLDDILETIRIQWERDVEKNRVEAGALLQAKQQAEVAHMSQTQEEKLAAALRVE
Form Liquid
Recomended Dilution Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BFSP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8419
Iso type IgG

Enviar uma mensagem


BFSP2 polyclonal antibody

BFSP2 polyclonal antibody