CPEB4 polyclonal antibody
  • CPEB4 polyclonal antibody

CPEB4 polyclonal antibody

Ref: AB-PAB23279
CPEB4 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CPEB4.
Información adicional
Size 100 uL
Gene Name CPEB4
Gene Alias KIAA1673
Gene Description cytoplasmic polyadenylation element binding protein 4
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq GDYGFGVLVQSNTGNKSAFPVRFHPHLQPPHHHQNATPSPAAFINNNTAANGSSA
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CPEB4.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 80315
Iso type IgG

Enviar uma mensagem


CPEB4 polyclonal antibody

CPEB4 polyclonal antibody