MTCH2 polyclonal antibody
  • MTCH2 polyclonal antibody

MTCH2 polyclonal antibody

Ref: AB-PAB23277
MTCH2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MTCH2.
Información adicional
Size 100 uL
Gene Name MTCH2
Gene Alias HSPC032
Gene Description mitochondrial carrier homolog 2 (C. elegans)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq VGYEPLPPTIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGP
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MTCH2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23788
Iso type IgG

Enviar uma mensagem


MTCH2 polyclonal antibody

MTCH2 polyclonal antibody