RICS polyclonal antibody
  • RICS polyclonal antibody

RICS polyclonal antibody

Ref: AB-PAB23276
RICS polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RICS.
Información adicional
Size 100 uL
Gene Name RICS
Gene Alias GC-GAP|GRIT|KIAA0712|MGC1892|p200RhoGAP|p250GAP
Gene Description Rho GTPase-activating protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ERDPSVLYQYQPHGKRQSSVTVVSQYDNLEDYHSLPQHQRGVFGGGGMGTYVPPGFPHPQSRTYATALGQGAFLPAELSLQHPETQIHAE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RICS.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9743
Iso type IgG

Enviar uma mensagem


RICS polyclonal antibody

RICS polyclonal antibody