SYNGAP1 polyclonal antibody
  • SYNGAP1 polyclonal antibody

SYNGAP1 polyclonal antibody

Ref: AB-PAB23273
SYNGAP1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SYNGAP1.
Información adicional
Size 100 uL
Gene Name SYNGAP1
Gene Alias DKFZp761G1421|KIAA1938|RASA1|RASA5|SYNGAP
Gene Description synaptic Ras GTPase activating protein 1 homolog (rat)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LHLYRDSDKKRKKDKAGYVGLVTVPVATLAGRHFTEQWYPVTLPTGSGGSGGMGSGGGGGSGGGSGGKGKGGCPAVRLKARYQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SYNGAP1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 8831
Iso type IgG

Enviar uma mensagem


SYNGAP1 polyclonal antibody

SYNGAP1 polyclonal antibody