NADKD1 polyclonal antibody
  • NADKD1 polyclonal antibody

NADKD1 polyclonal antibody

Ref: AB-PAB23271
NADKD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NADKD1.
Información adicional
Size 100 uL
Gene Name NADKD1
Gene Alias C5orf33
Gene Description NAD kinase domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RALNIERAHDERSEASGPQLLPVRALNEVFIGESLSSRASYYEISVDDGPWEKQKSSGLNLCTGTGSKAWSFNINRVATQAVEDVLNIAKRQGNLSL
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NADKD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 133686
Iso type IgG

Enviar uma mensagem


NADKD1 polyclonal antibody

NADKD1 polyclonal antibody