BUD13 polyclonal antibody
  • BUD13 polyclonal antibody

BUD13 polyclonal antibody

Ref: AB-PAB23267
BUD13 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant BUD13.
Información adicional
Size 100 uL
Gene Name BUD13
Gene Alias MGC13125|fSAP71
Gene Description BUD13 homolog (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq PGHQDSDSDLSPPRNRPRHRSSDSDLSPPRRRQRTKSSDSDLSPPRRSQPPGKKAAHMYSGAKTGLVLTDIQREQQELKEQDQETM
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human BUD13.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84811
Iso type IgG

Enviar uma mensagem


BUD13 polyclonal antibody

BUD13 polyclonal antibody