CCDC53 polyclonal antibody
  • CCDC53 polyclonal antibody

CCDC53 polyclonal antibody

Ref: AB-PAB23266
CCDC53 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant CCDC53.
Información adicional
Size 100 uL
Gene Name CCDC53
Gene Alias CGI-116
Gene Description coiled-coil domain containing 53
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LMGSGIDLTKVPAIQQKRTVAFLNQFVVHTVQFLNRFSTVCEEKLADLSLRIQQIETTLNILDAKLSSIPGLDDVTVEVSP
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human CCDC53.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 51019
Iso type IgG

Enviar uma mensagem


CCDC53 polyclonal antibody

CCDC53 polyclonal antibody