ECHDC3 polyclonal antibody
  • ECHDC3 polyclonal antibody

ECHDC3 polyclonal antibody

Ref: AB-PAB23264
ECHDC3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ECHDC3.
Información adicional
Size 100 uL
Gene Name ECHDC3
Gene Alias FLJ20909
Gene Description enoyl Coenzyme A hydratase domain containing 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq FTGEPISAQEALLHGLLSKVVPEAELQEETMRIARKIASLSRPVVSLGKATFYKQLPQDLGTAYYLTSQAMVDNLALRDGQEGITAFLQKRKPVWSH
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ECHDC3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79746
Iso type IgG

Enviar uma mensagem


ECHDC3 polyclonal antibody

ECHDC3 polyclonal antibody