ICHTHYIN polyclonal antibody
  • ICHTHYIN polyclonal antibody

ICHTHYIN polyclonal antibody

Ref: AB-PAB23251
ICHTHYIN polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ICHTHYIN.
Información adicional
Size 100 uL
Gene Name NIPAL4
Gene Alias ICHYN
Gene Description ichthyin protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq FKDLDISCASLPHMHKNPPPSPAPEPTVIRLEDKNVLVDNIELASTSSPEEKPKVFIIHS
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ICHTHYIN.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 348938
Iso type IgG

Enviar uma mensagem


ICHTHYIN polyclonal antibody

ICHTHYIN polyclonal antibody