DKFZP564O0823 polyclonal antibody
  • DKFZP564O0823 polyclonal antibody

DKFZP564O0823 polyclonal antibody

Ref: AB-PAB23247
DKFZP564O0823 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant DKFZP564O0823.
Información adicional
Size 100 uL
Gene Name DKFZP564O0823
Gene Alias -
Gene Description DKFZP564O0823 protein
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq VPPTTIWTSSPQNTDADTASPSNGTHNNSVLPVTASAPTSLLPKNISIESREEEITSPGSNWEGTNTDPSPSGFSSTSGGVHLTTTLEEHSSGT
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human DKFZP564O0823.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 25849
Iso type IgG

Enviar uma mensagem


DKFZP564O0823 polyclonal antibody

DKFZP564O0823 polyclonal antibody