RBM43 polyclonal antibody
  • RBM43 polyclonal antibody

RBM43 polyclonal antibody

Ref: AB-PAB23241
RBM43 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RBM43.
Información adicional
Size 100 uL
Gene Name RBM43
Gene Alias C2orf38|FLJ45645
Gene Description RNA binding motif protein 43
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RTLVPETARSGEMLVLDTDVFLYLKHKCGSYESTLKKFHILSQEKVDGEITTICLKSIQVGSQPNNA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RBM43.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 375287
Iso type IgG

Enviar uma mensagem


RBM43 polyclonal antibody

RBM43 polyclonal antibody