FAM204A polyclonal antibody
  • FAM204A polyclonal antibody

FAM204A polyclonal antibody

Ref: AB-PAB23236
FAM204A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM204A.
Información adicional
Size 100 uL
Gene Name FAM204A
Gene Alias RP11-319I23.1|C10orf84|bA319I23.1
Gene Description family with sequence similarity 204, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MWSGLLPPGLNESDAESNSEDEATLENSGLNLQEDKEDESIRKTEIIDFSTDEPKTETESNVNAYEECPSGIPID
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM204A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 63877
Iso type IgG

Enviar uma mensagem


FAM204A polyclonal antibody

FAM204A polyclonal antibody