SEC24B polyclonal antibody
  • SEC24B polyclonal antibody

SEC24B polyclonal antibody

Ref: AB-PAB23235
SEC24B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SEC24B.
Información adicional
Size 100 uL
Gene Name SEC24B
Gene Alias MGC48822|SEC24
Gene Description SEC24 family, member B (S. cerevisiae)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SFQGAASSASHLHTSASQPYSSFVNHYNSPAMYSASSSVASQGFPSTCGHYAMSTVSNAAYPSVSYPSLPAGDTYGQMFTSQNAPTVR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SEC24B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10427
Iso type IgG

Enviar uma mensagem


SEC24B polyclonal antibody

SEC24B polyclonal antibody