IQSEC1 polyclonal antibody
  • IQSEC1 polyclonal antibody

IQSEC1 polyclonal antibody

Ref: AB-PAB23229
IQSEC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IQSEC1.
Información adicional
Size 100 uL
Gene Name IQSEC1
Gene Alias ARFGEP100|KIAA0763
Gene Description IQ motif and Sec7 domain 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PSSETGTSLDSPSAYPQGPLVPGSSLSPDHYEHTSVGAYGLYSGPPGQQQRTRRPKLQHSTSILRKQAE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IQSEC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9922
Iso type IgG

Enviar uma mensagem


IQSEC1 polyclonal antibody

IQSEC1 polyclonal antibody