SH3TC1 polyclonal antibody
  • SH3TC1 polyclonal antibody

SH3TC1 polyclonal antibody

Ref: AB-PAB23226
SH3TC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SH3TC1.
Información adicional
Size 100 uL
Gene Name SH3TC1
Gene Alias FLJ20356|FLJ32999|FLJ36243|FLJ46394
Gene Description SH3 domain and tetratricopeptide repeats 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq RTVVMRPSVSWEKAGPEEAKAPVRGDEAPPARVAGPAAGTPPCQMGVYPTDLTLQLLAVRRKSRLRDPGLQQTLR
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SH3TC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54436
Iso type IgG

Enviar uma mensagem


SH3TC1 polyclonal antibody

SH3TC1 polyclonal antibody