SPATA7 polyclonal antibody
  • SPATA7 polyclonal antibody

SPATA7 polyclonal antibody

Ref: AB-PAB23217
SPATA7 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SPATA7.
Información adicional
Size 100 uL
Gene Name SPATA7
Gene Alias DKFZp686D07199|HSD-3.1|HSD3|MGC102934
Gene Description spermatogenesis associated 7
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq RHLLHVLKVDLGCTSEENSVKQNDVDMLNVFDFEKAGNSEPNELKNESEVTIQQERQQYQKALDMLLSAPKDENEIFPSPTEFFMPIYKSKHSEGV
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SPATA7.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 55812
Iso type IgG

Enviar uma mensagem


SPATA7 polyclonal antibody

SPATA7 polyclonal antibody