ATRNL1 polyclonal antibody
  • ATRNL1 polyclonal antibody

ATRNL1 polyclonal antibody

Ref: AB-PAB23214
ATRNL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ATRNL1.
Información adicional
Size 100 uL
Gene Name ATRNL1
Gene Alias ALP|FLJ45344|KIAA0534|bA338L11.1|bA454H24.1
Gene Description attractin-like 1
Storage Conditions Store at 4ºC. For long term storage store at -20ºC.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq PGEPNDSGFCAYLERAAVAGLKANPCTSMANGLVCEKPVVSPNQNARPCKKPCSLRTSCSNCTSNGMECMWCSSTKRCVDSN
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ATRNL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 26033
Iso type IgG

Enviar uma mensagem


ATRNL1 polyclonal antibody

ATRNL1 polyclonal antibody