FAM208B polyclonal antibody
  • FAM208B polyclonal antibody

FAM208B polyclonal antibody

Ref: AB-PAB23210
FAM208B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM208B.
Información adicional
Size 100 uL
Gene Name FAM208B
Gene Alias DKFZp781E1986|FLJ20360|bA318E3.2
Gene Description chromosome 10 open reading frame 18
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq SGTVTQATFTRTYDGPGSQPVICQSSVYGTLENKVDILDAAVQTKTGTLQDLIQHGSPINNECHPSLERKDDNMGCAVINPEPITLTFEKNAHVPIQTEGVNTADER
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM208B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54906
Iso type IgG

Enviar uma mensagem


FAM208B polyclonal antibody

FAM208B polyclonal antibody