PUS3 polyclonal antibody
  • PUS3 polyclonal antibody

PUS3 polyclonal antibody

Ref: AB-PAB23208
PUS3 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PUS3.
Información adicional
Size 100 uL
Gene Name PUS3
Gene Alias 2610020J05Rik|FKSG32|FLJ23638
Gene Description pseudouridylate synthase 3
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NLCKMDVANGVINFQRTILSAQVQLVGQSPGEGRWQEPFQLCQFEVTGQAFLYHQVRCMMAILFLIGQGMEKPEIIDELLN
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PUS3.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 83480
Iso type IgG

Enviar uma mensagem


PUS3 polyclonal antibody

PUS3 polyclonal antibody