SUMF1 polyclonal antibody
  • SUMF1 polyclonal antibody

SUMF1 polyclonal antibody

Ref: AB-PAB23205
SUMF1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SUMF1.
Información adicional
Size 100 uL
Gene Name SUMF1
Gene Alias AAPA3037|FGE|MGC131853|MGC150436
Gene Description sulfatase modifying factor 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq MDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHR
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SUMF1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 285362
Iso type IgG

Enviar uma mensagem


SUMF1 polyclonal antibody

SUMF1 polyclonal antibody