PSAPL1 polyclonal antibody
  • PSAPL1 polyclonal antibody

PSAPL1 polyclonal antibody

Ref: AB-PAB23202
PSAPL1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PSAPL1.
Información adicional
Size 100 uL
Gene Name PSAPL1
Gene Alias FLJ40379
Gene Description prosaposin-like 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq HFVTQYEPVLIESLKDMMDPVAVCKKVGACHGPRTPLLGTDQCALGPSFWCRSQEAAKLCNAVQHCQKHVWKEMHLHA
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PSAPL1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 768239
Iso type IgG

Enviar uma mensagem


PSAPL1 polyclonal antibody

PSAPL1 polyclonal antibody