MAP6D1 polyclonal antibody
  • MAP6D1 polyclonal antibody

MAP6D1 polyclonal antibody

Ref: AB-PAB23199
MAP6D1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MAP6D1.
Información adicional
Size 100 uL
Gene Name MAP6D1
Gene Alias FLJ12748|MAPO6D1|SL21
Gene Description MAP6 domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq GKSSAQSSAPPAPGARGVYVLPIGDADAAAAVTTSYRQEFQAWTGVKPSRSTKTKPARVITTHTSGWDSSPGAGFQVPEVRKKFTPNPSAIFQASAP
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MAP6D1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79929
Iso type IgG

Enviar uma mensagem


MAP6D1 polyclonal antibody

MAP6D1 polyclonal antibody