SLC34A2 polyclonal antibody
  • SLC34A2 polyclonal antibody

SLC34A2 polyclonal antibody

Ref: AB-PAB23198
SLC34A2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SLC34A2.
Información adicional
Size 100 uL
Gene Name SLC34A2
Gene Alias FLJ90534|NAPI-3B|NAPI-IIb|NPTIIb
Gene Description solute carrier family 34 (sodium phosphate), member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MRSLKPWDAVVSKFTGCFQMRCCCCCRVCCRACCLLCGCPKCCRCSKCCEDLEEAQEGQDVPVKAPETFDNITISREAQGEVPASDSKTECT
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SLC34A2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 10568
Iso type IgG

Enviar uma mensagem


SLC34A2 polyclonal antibody

SLC34A2 polyclonal antibody