PHLDB1 polyclonal antibody
  • PHLDB1 polyclonal antibody

PHLDB1 polyclonal antibody

Ref: AB-PAB23194
PHLDB1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PHLDB1.
Información adicional
Size 100 uL
Gene Name PHLDB1
Gene Alias DKFZp686H039|DKFZp686O24210|FLJ00141|FLJ90266|KIAA0638|LL5A|MGC111531
Gene Description pleckstrin homology-like domain, family B, member 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq AILDSQAGQIRAQAVQESERLARDKNASLQLLQKEKEKLTVLERRYHSLTGGRPFPKTTSTLKEMEKLLLPAVDLEQWYQELM
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PHLDB1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23187
Iso type IgG

Enviar uma mensagem


PHLDB1 polyclonal antibody

PHLDB1 polyclonal antibody