C11orf60 polyclonal antibody
  • C11orf60 polyclonal antibody

C11orf60 polyclonal antibody

Ref: AB-PAB23184
C11orf60 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C11orf60.
Información adicional
Size 100 uL
Gene Name C11orf60
Gene Alias C11orf2|FLJ21827
Gene Description chromosome 11 open reading frame 60
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq ETDSDSDDDDEEHGAPLEGAYDPADYEHLPVSAEIKELFQYISRYTPQLIDLDHKLKPFIPDFIPAVGDIDAFLKVPRPDGKPDNLGLLV
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C11orf60.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56912
Iso type IgG

Enviar uma mensagem


C11orf60 polyclonal antibody

C11orf60 polyclonal antibody