NSUN2 polyclonal antibody
  • NSUN2 polyclonal antibody

NSUN2 polyclonal antibody

Ref: AB-PAB23182
NSUN2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NSUN2.
Información adicional
Size 100 uL
Gene Name NSUN2
Gene Alias FLJ20303|MISU|SAKI|TRM4
Gene Description NOL1/NOP2/Sun domain family, member 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq PFVFIPEDDPLFPPIEKFYALDPSFPRMNLLTRTTEGKKRQLYMVSKELRNVLLNNSEKMKVINTGIKVWCRNNSGEEFDCAFRLAQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NSUN2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 54888
Iso type IgG

Enviar uma mensagem


NSUN2 polyclonal antibody

NSUN2 polyclonal antibody