KTELC1 polyclonal antibody
  • KTELC1 polyclonal antibody

KTELC1 polyclonal antibody

Ref: AB-PAB23177
KTELC1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant KTELC1.
Información adicional
Size 100 uL
Gene Name KTELC1
Gene Alias C3orf9|CLP46|KDELCL1|MDS010|MDSRP|MGC32995|hCLP46
Gene Description KTEL (Lys-Tyr-Glu-Leu) containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq VQELLQFVKANDDVAQEIAERGSQFIRNHLQMDDITCYWENLLSEYSKFLSYNVTRRKGYDQIIPKMLKTEL
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human KTELC1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56983
Iso type IgG

Enviar uma mensagem


KTELC1 polyclonal antibody

KTELC1 polyclonal antibody