LRIT2 polyclonal antibody
  • LRIT2 polyclonal antibody

LRIT2 polyclonal antibody

Ref: AB-PAB23165
LRIT2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant LRIT2.
Información adicional
Size 100 uL
Gene Name LRIT2
Gene Alias LRRC22
Gene Description leucine-rich repeat, immunoglobulin-like and transmembrane domains 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LVISLHVQPAQALHAPDSLSIPSEGNAYIDLRVVKQTVHGILLEWLAVADTSKEEWFTLYIASDEAFRKEVVHIGPGINTYAVDDLLPGTKYE
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human LRIT2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 340745
Iso type IgG

Enviar uma mensagem


LRIT2 polyclonal antibody

LRIT2 polyclonal antibody