TMEM9B polyclonal antibody
  • TMEM9B polyclonal antibody

TMEM9B polyclonal antibody

Ref: AB-PAB23164
TMEM9B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant TMEM9B.
Información adicional
Size 100 uL
Gene Name TMEM9B
Gene Alias C11orf15
Gene Description TMEM9 domain family, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq EPILKRRLFGHAQLIQSDDDIGDHQPFANAHDVLARSRSRANVLNKVEYAQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human TMEM9B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 56674
Iso type IgG

Enviar uma mensagem


TMEM9B polyclonal antibody

TMEM9B polyclonal antibody