PSTK polyclonal antibody
  • PSTK polyclonal antibody

PSTK polyclonal antibody

Ref: AB-PAB23163
PSTK polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant PSTK.
Información adicional
Size 100 uL
Gene Name PSTK
Gene Alias C10orf89|MGC35392
Gene Description phosphoseryl-tRNA kinase
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LPPETIHLMGRKLEKPNPEKNAWEHNSLTIPSPACASEASLEVTDLLLTALENPVKYAEDNMEQKDTDRIICSTN
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human PSTK.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 118672
Iso type IgG

Enviar uma mensagem


PSTK polyclonal antibody

PSTK polyclonal antibody