NUP155 polyclonal antibody
  • NUP155 polyclonal antibody

NUP155 polyclonal antibody

Ref: AB-PAB23161
NUP155 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant NUP155.
Información adicional
Size 100 uL
Gene Name NUP155
Gene Alias KIAA0791|N155
Gene Description nucleoporin 155kDa
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq TPSHGIQPPAMSTPVCALGNPATQATNMSCVTGPEIVYSGKHNGICIYFSRIMGNIWDASLVVERIFKSGNREITAIESSVPCQLL
Form Liquid
Recomended Dilution Immunohistochemistry (1:10-1:20)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human NUP155.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9631
Iso type IgG

Enviar uma mensagem


NUP155 polyclonal antibody

NUP155 polyclonal antibody