IGSF9 polyclonal antibody
  • IGSF9 polyclonal antibody

IGSF9 polyclonal antibody

Ref: AB-PAB23157
IGSF9 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant IGSF9.
Información adicional
Size 100 uL
Gene Name IGSF9
Gene Alias FP18798|IGSF9A|KIAA1355|Nrt1
Gene Description immunoglobulin superfamily, member 9
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq TPLPIGMPGVIRCPVRANPPLLFVSWTKDGKALQLDKFPGWSQGTEGSLIIALGNEDALGEYSCTPYNSLGTAGPSPVTRVLLKAPPAFIERPKEEYFQEVG
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human IGSF9.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57549
Iso type IgG

Enviar uma mensagem


IGSF9 polyclonal antibody

IGSF9 polyclonal antibody