FAM53B polyclonal antibody
  • FAM53B polyclonal antibody

FAM53B polyclonal antibody

Ref: AB-PAB23156
FAM53B polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM53B.
Información adicional
Size 100 uL
Gene Name FAM53B
Gene Alias KIAA0140|RP11-12J10.2|bA12J10.2
Gene Description family with sequence similarity 53, member B
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq NGFSTMQRSSSFSLPSRANVLSSPCDQAGLHHRFGGQPCQGVPGSAPCGQAGDTWSPDLHPVGGGRLDLQRSLSCSHEQFSFVEYCPPSAN
Form Liquid
Recomended Dilution Immunohistochemistry (1:50-1:200)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM53B.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 9679
Iso type IgG

Enviar uma mensagem


FAM53B polyclonal antibody

FAM53B polyclonal antibody