ZNF527 polyclonal antibody
  • ZNF527 polyclonal antibody

ZNF527 polyclonal antibody

Ref: AB-PAB23155
ZNF527 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ZNF527.
Información adicional
Size 100 uL
Gene Name ZNF527
Gene Alias KIAA1829
Gene Description zinc finger protein 527
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq LVWLDWESWCEIEELSPKWFIDEDEISQEMVMERLASHGLECSSFREAWKYKGEFELHQGNAERHFMQVTA
Form Liquid
Recomended Dilution Immunohistochemistry (1:2500-1:5000)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ZNF527.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84503
Iso type IgG

Enviar uma mensagem


ZNF527 polyclonal antibody

ZNF527 polyclonal antibody