RAB11FIP2 polyclonal antibody
  • RAB11FIP2 polyclonal antibody

RAB11FIP2 polyclonal antibody

Ref: AB-PAB23154
RAB11FIP2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RAB11FIP2.
Información adicional
Size 100 uL
Gene Name RAB11FIP2
Gene Alias KIAA0941|Rab11-FIP2|nRip11
Gene Description RAB11 family interacting protein 2 (class I)
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq HMPDANSEFSSGEIQMKSKPKKPFLLGPQRLSSAHSMSDLSGSHMSSEKLKAGTIGQTHLLGHQLDSFGTVPESGSLKSPHRRTLSFDTSKMN
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RAB11FIP2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 22841
Iso type IgG

Enviar uma mensagem


RAB11FIP2 polyclonal antibody

RAB11FIP2 polyclonal antibody