FCHO2 polyclonal antibody
  • FCHO2 polyclonal antibody

FCHO2 polyclonal antibody

Ref: AB-PAB23150
FCHO2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FCHO2.
Información adicional
Size 100 uL
Gene Name FCHO2
Gene Alias -
Gene Description FCH domain only 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq KGTGKERPGLIEFEECDTASAVEGIKPRKRKTFALPGIIKKEKDAESVECPDADSLNIPDVDEEGYSI
Form Liquid
Recomended Dilution Immunohistochemistry (1:20-1:50)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FCHO2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 115548
Iso type IgG

Enviar uma mensagem


FCHO2 polyclonal antibody

FCHO2 polyclonal antibody