SH3TC2 polyclonal antibody
  • SH3TC2 polyclonal antibody

SH3TC2 polyclonal antibody

Ref: AB-PAB23149
SH3TC2 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant SH3TC2.
Información adicional
Size 100 uL
Gene Name SH3TC2
Gene Alias CMT4C|FLJ13605|KIAA1985
Gene Description SH3 domain and tetratricopeptide repeats 2
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq SVLSFLYDKKYLPHLAVASVQQHGIQSAQGMSLPIWQVHLVLQNTTKLLGFPSPGWGEVSALACPMLRQALAACEELADRSTQRALCLILSKVYLEHRSPDGAIHYLSQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human SH3TC2.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 79628
Iso type IgG

Enviar uma mensagem


SH3TC2 polyclonal antibody

SH3TC2 polyclonal antibody