C10orf32 polyclonal antibody
  • C10orf32 polyclonal antibody

C10orf32 polyclonal antibody

Ref: AB-PAB23142
C10orf32 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant C10orf32.
Información adicional
Size 100 uL
Gene Name C10orf32
Gene Alias DKFZp686B2219|FLJ40752|MGC27171|RP11-753C18.6
Gene Description chromosome 10 open reading frame 32
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB,IHC-P
Immunogen Prot. Seq FGQSVKGLLTEKVTTCGTDVIALTKQVLKGSRSSELLGQAARNMVLQEDAILHSEDSLRKMAIITTHLQYQQEAIQKNVEQSSDLQDQLNHLLK
Form Liquid
Recomended Dilution Immunohistochemistry (1:500-1:1000)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human C10orf32.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 119032
Iso type IgG

Enviar uma mensagem


C10orf32 polyclonal antibody

C10orf32 polyclonal antibody