RGNEF polyclonal antibody
  • RGNEF polyclonal antibody

RGNEF polyclonal antibody

Ref: AB-PAB23138
RGNEF polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant RGNEF.
Información adicional
Size 100 uL
Gene Name RGNEF
Gene Alias DKFZp686P12164|FLJ21817|KIAA1998
Gene Description Rho-guanine nucleotide exchange factor
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,IF
Immunogen Prot. Seq GTAHTEAQQSFMSPSSSCASNLNLSFGWHGFEKEQSHLKKRSSSLDALDADSEGEGHSEPSHICYTPGSQSSSRTGIPSGDELDSFETNTEPDFNI
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
Immunofluorescence (1-4 ug/mL)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human RGNEF.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 64283
Iso type IgG

Enviar uma mensagem


RGNEF polyclonal antibody

RGNEF polyclonal antibody