FAM168A polyclonal antibody
  • FAM168A polyclonal antibody

FAM168A polyclonal antibody

Ref: AB-PAB23136
FAM168A polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant FAM168A.
Información adicional
Size 100 uL
Gene Name FAM168A
Gene Alias KIAA0280|TCRP1
Gene Description family with sequence similarity 168, member A
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq MNPVYSPVQPGAPYGNPKNMAYTGYPTAYPAAAPAYNPSLYPTNSPSYAPEFQFLHSAYATLLMKQAWPQNSSSCGTEGTFHLPVDTGTENRTY
Form Liquid
Recomended Dilution The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human FAM168A.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 23201
Iso type IgG

Enviar uma mensagem


FAM168A polyclonal antibody

FAM168A polyclonal antibody