ATAD1 polyclonal antibody
  • ATAD1 polyclonal antibody

ATAD1 polyclonal antibody

Ref: AB-PAB23135
ATAD1 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant ATAD1.
Información adicional
Size 100 uL
Gene Name ATAD1
Gene Alias AFDC1|FLJ14600|FNP001
Gene Description ATPase family, AAA domain containing 1
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P
Immunogen Prot. Seq NVDRHVDLLEVAQETDGFSGSDLKEMCRDAALLCVREYVNSTSEESHDEDEIRPVQQQDLHRAIEKMKKSKDAAFQ
Form Liquid
Recomended Dilution Immunohistochemistry (1:200-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human ATAD1.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 84896
Iso type IgG

Enviar uma mensagem


ATAD1 polyclonal antibody

ATAD1 polyclonal antibody