MRPL47 polyclonal antibody
  • MRPL47 polyclonal antibody

MRPL47 polyclonal antibody

Ref: AB-PAB23132
MRPL47 polyclonal antibody

Información del producto

Rabbit polyclonal antibody raised against recombinant MRPL47.
Información adicional
Size 100 uL
Gene Name MRPL47
Gene Alias CGI-204|MGC45403|NCM1
Gene Description mitochondrial ribosomal protein L47
Storage Conditions Store at 4C. For long term storage store at -20C.
Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IHC-P
Immunogen Prot. Seq LKERNMLLTLEQEAKRQRLPMPSPERLDKVVDSMDALDKVVQEREDALRLLQTGQERARPGAWRRDIFGRIIWHKFKQWVI
Form Liquid
Recomended Dilution Immunohistochemistry (1:1000-1:2500)
Western Blot (1:250-1:500)
The optimal working dilution should be determined by the end user.
Antigen species Target species Human
Immunogen Recombinant protein corresponding to amino acids of human MRPL47.
Storage Buffer In PBS, pH 7.2 (40% glycerol, 0.02% sodium azide)
Gene ID 57129
Iso type IgG

Enviar uma mensagem


MRPL47 polyclonal antibody

MRPL47 polyclonal antibody